Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PKMYT1 pThr495 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T495 of human MYT1. |
PKMYT1 (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human PKMYT1. |
PKMYT1 pSer83 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Serine 83(R-V-S(p)-F-R) derived from Human MYT1 (KLH-conjugated) |
PKMYT1 pSer83 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Serine 83(R-V-S(p)-F-R) derived from Human MYT1 (KLH-conjugated) |
Rabbit Polyclonal Anti-Myt1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS |
PKMYT1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PKMYT1. |
| Modifications | Unmodified |
Rabbit polyclonal MYT1 (Ser83) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R). |
| Modifications | Phospho-specific |
Active filters
Target Symbol
- PKMYT1
Antibody Hosts
- Rabbit