Rabbit Polyclonal Anti-NR1D1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NR1D1 |
Rabbit Polyclonal Anti-NR1D1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NR1D1 |
Rev-Erbα/NR1D1 Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Rev-Erbα/Rev-Erbα/NR1D1. |
Rabbit Polyclonal Anti-NR1D1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the N terminal of human NR1D1. Synthetic peptide located within the following region: NGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSS |
Rabbit Polyclonal Anti-NR1D1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the middle region of human NR1D1. Synthetic peptide located within the following region: SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA |
Rev-Erbα polyclonal antibody
Applications | WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to Human Rev-Erbα. |