Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NR1D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the N terminal of human NR1D1. Synthetic peptide located within the following region: NGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSS |
Rabbit Polyclonal Anti-NR1D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the middle region of human NR1D1. Synthetic peptide located within the following region: SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA |
Rev-Erbα polyclonal antibody
| Applications | WB |
| Reactivities | Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to Human Rev-Erbα. |
Active filters
Target Symbol
- NR1D1
Antibody Hosts
- Rabbit