Anti-NPPC Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 111-125 amino acids of Human notch 4 |
Anti-NPPC Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 111-125 amino acids of Human notch 4 |
Rabbit Polyclonal Anti-NPPC Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Nppc antibody is: synthetic peptide directed towards the C-terminal region of Nppc. Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS |
Rabbit polyclonal anti C-Type Natriuretic Peptide (1-29) (ms, po, rat); neat antiserum
Applications | ELISA |
Reactivities | Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp- Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn- OH coupled to a carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (1-29) (ms, po, rt); purified rabbit IgG
Applications | ELISA |
Reactivities | Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp- Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn- OH coupled to a carrier protein. |
Rabbit polyclonal anti human / porcine / rat C-Type Natriuretic Peptide (CNP) (32-53)
Applications | ELISA |
Reactivities | Human, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (32-53) (hu, po, rt); neat antiserum
Applications | ELISA |
Reactivities | Human, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH, (Disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (32-53) (hu, po, rt); diluted antiserum
Applications | ELISA |
Reactivities | Human, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH, (Disulfide bond) coupled to carrier protein. |