LCOR (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 329-358 amino acids from the C-terminal region of Human LCOR |
LCOR (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 329-358 amino acids from the C-terminal region of Human LCOR |
Rabbit polyclonal anti-A630025C20RIK antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-A630025C20RIK antibody: synthetic peptide directed towards the N terminal of mouse A630025C20RIK. Synthetic peptide located within the following region: QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK |
Rabbit Polyclonal Anti-LCOR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LCOR antibody: synthetic peptide directed towards the C terminal of human LCOR. Synthetic peptide located within the following region: EGDPGSKQPRKKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHS |
Rabbit Polyclonal Anti-LCOR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LCOR antibody: synthetic peptide directed towards the middle region of human LCOR. Synthetic peptide located within the following region: NLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVD |