Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Recombinant Anti-CD123 (Clone 7G3)
| Applications | Bl, FC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL3RA Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IL3RA (NP_002174.1). |
| Modifications | Unmodified |
Rabbit polyclonal IL3RA Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA. |
Rabbit Polyclonal Anti-IL3RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS |
IL3RA polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to Human IL3RA. |
CD123 (S47) polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 1-100 of Human CD123. |
CD123 (Q192) polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 150-250 of Human CD123. |
Active filters
Target Symbol
- IL3RA
Antibody Hosts
- Rabbit