Antibodies

View as table Download

HMBS rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMBS

Rabbit anti-HMBS Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HMBS

Rabbit Polyclonal Anti-HMBS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMBS antibody: synthetic peptide directed towards the N terminal of human HMBS. Synthetic peptide located within the following region: MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA

Rabbit Polyclonal Anti-HMBS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMBS antibody: synthetic peptide directed towards the middle region of human HMBS. Synthetic peptide located within the following region: SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR

HMBS rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMBS