Antibodies

View as table Download

FOXP4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXP4

FOXP4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXP4

Recombinant Anti-FOXP4 (Clone RAB-S40)

Applications ELISA, FC, IF
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the C terminal of human FOXP4. Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE

Rabbit Polyclonal anti-FOXP4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the middle region of human FOXP4. Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QEDLGVPGEPLPSNGSSSPPRLSPPQYSHQIQVKEEPAEAEEDRRPGPPL

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXP4 antibody: synthetic peptide directed towards the N terminal of human FOXP4. Synthetic peptide located within the following region: MVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGAD

Rabbit Polyclonal Anti-FOXP4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti FOXP4 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human FOXP4 protein. This sequence is identical within human, mouse, rat origins.