Germany
Japan
United Kingdom
China
Antibodies
View as table Download
DAZL rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from internal domain of Human DAZL protein. |
Rabbit Polyclonal Anti-DAZL Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DAZL antibody is: synthetic peptide directed towards the C-terminal region of Human DAZL. Synthetic peptide located within the following region: PPSGNGPQKKSVDRSIQTVVSCLFNPENRLRNSVVTQDDYFKDKRVHHFR |
Rabbit Polyclonal Anti-DAZL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DAZL antibody: synthetic peptide directed towards the C terminal of human DAZL. Synthetic peptide located within the following region: EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR |
DAZL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DAZL |
DAZL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 186-295 of human DAZL (NP_001342.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- DAZL
Antibody Hosts
- Rabbit