Germany
Japan
United Kingdom
China
Btn2a2 rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides derived from internal domain of Mouse Btn2a2 protein |
Antibodies
View as table Download
Rabbit Polyclonal Anti-BTN2A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BTN2A2 Antibody is: synthetic peptide directed towards the N-terminal region of Human BTN2A2. Synthetic peptide located within the following region: EDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVA |
BTN2A2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BTN2A2 |
Active filters
Target Symbol
- BTN2A2
Antibody Hosts
- Rabbit