Antibodies

View as table Download

RAB31 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated

RAB31 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human RAB31 (NP_006859.2).
Modifications Unmodified

Rabbit polyclonal anti-RAB31 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAB31.

Rabbit Polyclonal Anti-RAB31 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Rab31 antibody is: synthetic peptide directed towards the middle region of Rat Rab31. Synthetic peptide located within the following region: GSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIR

RAB31 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-195 of human RAB31 (NP_006859.2).
Modifications Unmodified