PISD rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PISD |
PISD rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PISD |
PISD (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | conjugated synthetic peptide selected from the Center region of human PISD |
Rabbit Polyclonal Anti-PISD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PISD antibody is: synthetic peptide directed towards the C-terminal region of Human PISD. Synthetic peptide located within the following region: WKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR |
Rabbit Polyclonal Anti-PISD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PISD antibody is: synthetic peptide directed towards the C-terminal region of Human PISD. Synthetic peptide located within the following region: MCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDW |
PISD Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-375 of human PISD (NP_055153.1). |
Modifications | Unmodified |