Antibodies

View as table Download

GUCY1B1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GUCY1B1

GUCY1B1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human GCS-β-1.

Rabbit polyclonal Guanylate Cyclase beta antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Guanylate Cyclase β.

GUCY1B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GUCY1B1

GUCY1B1 (C-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human GUCY1B3.

Rabbit Polyclonal Anti-GUCY1B3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GUCY1B3 antibody: synthetic peptide directed towards the N terminal of human GUCY1B3. Synthetic peptide located within the following region: LIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVV

Rabbit Polyclonal Anti-GCYB1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GCYB1 Antibody: A synthesized peptide derived from human GCYB1

GUCY1B1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

GUCY1B1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS