Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-PDK1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDK1 antibody: synthetic peptide directed towards the middle region of human PDK1. Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY |
PDK1 (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human PDK1. |
Rabbit Polyclonal Antibody against PDK1
| Applications | Immunoblotting, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human PDK1 protein sequence (between residues 300-400). [Swiss-Prot Q15118] |
Rabbit polyclonal PDK1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PDK1. |
PDK1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of mouse PDK1 |
PDK1/PDHK1 Rabbit polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PDK1/PDHK1 (NP_002601.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PDK1
Antibody Hosts
- Rabbit