Antibodies

Jump to Filters
View as table Download
Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody
TA323747

USD 380.00

4 Weeks

Anti-CA2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody
AP20569PU-N

USD 465.00

3 Weeks

Carbonic Anhydrase II (CA2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 201-250 of Human CA II.
Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody
TA323748

USD 380.00

In Stock

Anti-CA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody
TA342840

USD 539.00

5 Days

Rabbit Polyclonal Anti-CA2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CA2 antibody: synthetic peptide directed towards the N terminal of human CA2. Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH