Antibodies

Jump to Filters
View as table Download
SLIT1 Rabbit Polyclonal Antibody
TA351719

USD 380.00

In Stock

Rabbit Polyclonal Anti-SLIT1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLIT1
SLIT1 (487-504) Rabbit Polyclonal Antibody
AP07867PU-N

USD 555.00

2 Weeks

SLIT1 (487-504) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Chicken, Frog, Rat
Conjugation Unconjugated
Immunogen Synthetic Peptide corresponding to aa 487-504 of Mouse SLIT-1 protein
SLIT1 Rabbit Polyclonal Antibody
TA344212

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLIT1 Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SLIT1 antibody: synthetic peptide directed towards the middle region of human SLIT1. Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
SLIT1 Rabbit Polyclonal Antibody
TA381727

USD 365.00

3 Weeks

SLIT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1315-1534 of human SLIT1 (NP_003052.2).
Modifications Unmodified