Antibodies

View as table Download

Rabbit Polyclonal EGLN3/PHD3 Antibody

Applications ChIP, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminus of humanPHD3/HIF Prolyl Hydroxylase 3. [LocusLink ID 112399]

Rabbit Polyclonal HIF Prolyl Hydroxylase 3 Antibody

Applications ChIP, Electron Microscopy, ICC/IF, IHC, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues between 50-100 of human Prolyl Hydroxylase Domain-Containing Protein 3 using the numbering given in entry NP_071356.1 (GeneID 112399).

Anti-EGLN3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-EGLN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3. Synthetic peptide located within the following region: FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT