Antibodies

View as table Download

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin

Rabbit Polyclonal Anti-GSN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN

GSN Rabbit Polyclonal Antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GSN