Rabbit Polyclonal Anti-GNRH1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNRH1 |
Rabbit Polyclonal Anti-GNRH1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNRH1 |
GnRH (GNRH1) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mammalian |
Conjugation | Unconjugated |
Rabbit anti-GNRH1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GNRH1 |
GNRH1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |