Rabbit Polyclonal Anti-VPS37A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human VPS37A |
Rabbit Polyclonal Anti-VPS37A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human VPS37A |
Rabbit Polyclonal Anti-VPS37A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VPS37A antibody: synthetic peptide directed towards the N terminal of human VPS37A. Synthetic peptide located within the following region: SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE |