Antibodies

View as table Download

Rabbit Polyclonal Anti-VPS37A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VPS37A

Rabbit Polyclonal Anti-VPS37A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS37A antibody: synthetic peptide directed towards the N terminal of human VPS37A. Synthetic peptide located within the following region: SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE