Antibodies

View as table Download

Rabbit Polyclonal Anti-XYLT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the middle region of human XYLT2. Synthetic peptide located within the following region: PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW

Rabbit Polyclonal Anti-XYLT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the C terminal of human XYLT2. Synthetic peptide located within the following region: LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Rabbit anti-B3GAT1 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human CD57.

Rabbit polyclonal Anti-CHSY

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHSY-2 antibody: synthetic peptide directed towards the N terminal of human CHSY-2. Synthetic peptide located within the following region: PPLQQRRRGREPEGATGLPGAPAAEGEPEEEDGGAAGQRRDGRPGSSHNG

Rabbit Polyclonal Anti-XYLT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XYLT1 antibody: synthetic peptide directed towards the middle region of human XYLT1. Synthetic peptide located within the following region: RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF

CSGALNACT2 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CSGALNACT2

B3GAT2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 130-158 amino acids from the Central region of human B3GAT2

B3GAT3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 300-329 amino acids from the C-terminal region of human B3GAT3

XYLT1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 133-163 amino acids from the N-terminal region of human XYLT1

Rabbit polyclonal anti-CHST14 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST14 antibody: synthetic peptide directed towards the middle region of human CHST14. Synthetic peptide located within the following region: REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM

Rabbit polyclonal Anti-CHST13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST13 antibody: synthetic peptide directed towards the N terminal of human CHST13. Synthetic peptide located within the following region: ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR

Rabbit polyclonal Anti-CHST13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST13 antibody: synthetic peptide directed towards the C terminal of human CHST13. Synthetic peptide located within the following region: CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL

Rabbit Polyclonal Anti-B3GAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3GAT1 antibody is: synthetic peptide directed towards the N-terminal region of Human B3GAT1. Synthetic peptide located within the following region: LAPLLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPP

Rabbit Polyclonal Anti-UST Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UST antibody: synthetic peptide directed towards the N terminal of human UST. Synthetic peptide located within the following region: PPRFLLDLRQYLGNSTYLDDHGPPPSKVLPFPSQVVYNRVGKCGSRTVVL

Rabbit Polyclonal Anti-B3GAT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-B3GAT3 antibody: synthetic peptide directed towards the N terminal of human B3GAT3. Synthetic peptide located within the following region: PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY