Rabbit Polyclonal antibody to RanBP16 (exportin 7)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Chicken, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 902 and 1087 of RanBP16 (Uniprot ID#Q9UIA9) |
Rabbit Polyclonal Anti-XPO7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XPO7 antibody is: synthetic peptide directed towards the C-terminal region of Human XPO7. Synthetic peptide located within the following region: PLLGLILLNEKYFSDLRNSIVNSQPPEKQQAMHLCFENLMEGIERNLLTK |
Germany
Japan
United Kingdom
China
