Antibodies

View as table Download

OXSM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human OXSM

OXSM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human OXSM

Rabbit Polyclonal Anti-OXSM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OXSM antibody: synthetic peptide directed towards the middle region of human OXSM. Synthetic peptide located within the following region: HAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQP

OXSM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 80-459 of human OXSM (NP_060367.1).
Modifications Unmodified