Rabbit polyclonal anti-OPN5 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OPN5. |
Rabbit polyclonal anti-OPN5 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OPN5. |
Rabbit polyclonal antibody to neuropsin (opsin 5)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 110 and 203 of Opsin 5 (Uniprot ID#Q6U736) |
Rabbit Polyclonal Anti-OPN5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OPN5 antibody: synthetic peptide directed towards the C terminal of human OPN5. Synthetic peptide located within the following region: FFCLLLPTAVIVFSYVKIIAKVKSSSKEVAHFDSRIHSSHVLEMKLTKVA |