Antibodies

View as table Download

DNMT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DNMT1.
Modifications Unmodified

DNMT1 Rabbit polyclonal Antibody

Applications ChIP, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein of Human DNMT1.
Modifications Unmodified

DNMT1 Rabbit polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human DNMT1 (NP_001370.1).
Modifications Unmodified

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1
TA323184 is a possible alternative to TA323183.

Dnmt1 Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal DNMT1 Antibody

Applications ELISA, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DNMT1 antibody: mouse DNMT1 (DNA (cytosine-5)-methyltransferase 1), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the C-terminal part of the protein.

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

DNMT1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human DNMT1.

Dnmt1 Rabbit polyclonal Antibody

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Dnmt1

Rabbit Polyclonal Anti-Dnmt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dnmt1 antibody: synthetic peptide directed towards the N terminal of mouse Dnmt1. Synthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR