Antibodies

Jump to Filters
View as table Download
TXN Rabbit Polyclonal Antibody
TA322865

USD 380.00

4 Weeks

Anti-TXN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 90-105 amino acids of human thioredoxin
TXN Rabbit Polyclonal Antibody
TA322867

USD 380.00

In Stock

Anti-TXN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 91-105 amino acids of human thioredoxin
TA322867 is a possible alternative to TA322866.
TXN Rabbit Polyclonal Antibody
TA322864

USD 380.00

4 Weeks

Anti-TXN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 90-105 amino acids of human thioredoxin
TXN Rabbit Polyclonal Antibody
TA382956

USD 365.00

3 Weeks

Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Modifications Unmodified
TXN Rabbit Polyclonal Antibody
TA382955

USD 365.00

3 Weeks

Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Modifications Unmodified
TXN Rabbit Polyclonal Antibody
TA330906

USD 539.00

5 Days

Rabbit Polyclonal Anti-TXN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TXN antibody is: synthetic peptide directed towards the C-terminal region of Human TXN. Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT
TXN Rabbit Polyclonal Antibody
TA325133

USD 580.00

5 Days

Rabbit polyclonal TXN Antibody (C-term)

Applications WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Pig, Rabbit)
Conjugation Unconjugated
Immunogen This TXN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-94 amino acids from the C-terminal region of human TXN.
TXN Rabbit Polyclonal Antibody
TA382954

USD 365.00

3 Weeks

Thioredoxin 1 (Trx1/TXN) Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
Modifications Unmodified