Antibodies

Jump to Filters
View as table Download
TLR7 (900-950) Rabbit Polyclonal Antibody
AP23604PU-N

USD 535.00

2 Weeks

TLR7 (900-950) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Canine, Equine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from a portion of amino acids 900-950 of Human TLR7
XPR1 (N-term) Rabbit Polyclonal Antibody
AP24003PU-N

USD 515.00

2 Weeks

XPR1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Bovine, Bat, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic 16 amino acid peptide from the N-terminal cytoplasmic domain of human XPR1.
Muscarinic Acetylcholine Receptor M3 (CHRM3) Rabbit Polyclonal Antibody
TA316627

USD 515.00

In Stock

CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey, Gibbon, Orang-Utan (Predicted: Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Guinea Pig)
Conjugation Unconjugated
Immunogen CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%).
HCAR1 Rabbit Polyclonal Antibody
TA316878

USD 515.00

5 Days

FKSG80 / GPR81 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Rabbit, Rat, Hamster (Predicted: Mouse, Horse, Pig)
Conjugation Unconjugated
Immunogen FKSG80 / GPR81 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human GPR81. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Rat, Dog, Bat, Hamster, Panda, Rabbit, Opossum (100%); Mouse, Horse, Pig, Platypus (94%); Bovine (88%); Elephant (81%).
Cannabinoid Receptor II (CNR2) Rabbit Polyclonal Antibody
TA317640

USD 515.00

5 Days

CNR2 / CB2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Dog, Gorilla, Human, Monkey, Gibbon (Predicted: Mouse, Rat, Bat, Hamster, Horse)
Conjugation Unconjugated
Immunogen CNR2 / CB2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CNR2 / CB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Mouse, Rat, Elephant, Panda (95%); Hamster, Bat, Horse (90%); Rabbit (85%).
CRLR (CALCRL) Rabbit Polyclonal Antibody
TA316587

USD 515.00

5 Days

CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Gibbon, Orang-Utan (Predicted: Monkey, Mouse, Rabbit)
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%).
SRD5A2 Rabbit Polyclonal Antibody
TA335223

USD 539.00

5 Days

Rabbit Polyclonal Anti-SRD5A2 Antibody

Applications IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR
GPR37 Rabbit Polyclonal Antibody
TA340808

USD 515.00

5 Days

Rabbit Polyclonal Anti-GPR37 Antibody (N-Terminus)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen PAEL Receptor / GPR37 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human GPR37. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (95%); Marmoset (90%); Rabbit (85%); Panda (80%).
GPR183 Rabbit Polyclonal Antibody
TA316825

USD 515.00

2 Weeks

GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human (Predicted: Monkey, Mouse, Rat, Bat, Bovine, Dog, Hamster, Horse, Pig, Rabbit)
Conjugation Unconjugated
Immunogen GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%).
KiSS1 receptor (KISS1R) Rabbit Polyclonal Antibody
TA340626

USD 515.00

5 Days

Rabbit Polyclonal Anti-KISS1R Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human (Predicted: Monkey, Mouse, Bat, Dog)
Conjugation Unconjugated
Immunogen KISS1R / GPR54 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human KISS1R / GPR54. Percent identity with other species by BLAST analysis: Human, Gorilla, Bovine, Goat, Pig (100%); Monkey, Mouse, Bat, Dog (94%); Gibbon, Marmoset, Rat, Hamster (89%).
LHCGR Rabbit Polyclonal Antibody
TA340817

USD 515.00

5 Days

Rabbit Polyclonal Anti-LHCGR Antibody (C-Terminus)

Applications IHC
Reactivities Human (Predicted: Monkey, Rat, Dog)
Conjugation Unconjugated
Immunogen LHCGR / LHR / LH Receptor antibody was raised against synthetic 19 amino acid peptide from C-terminus of human hCG receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Rat, Dog, Panda (95%); Bovine, Bat, Rabbit, Horse (89%); Ferret (84%).
MUPCDH (CDHR5) Rabbit Polyclonal Antibody
TA341274

USD 515.00

5 Days

Rabbit Polyclonal Anti-CDHR5 Antibody (Internal)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen CDHR5 / MUCDHL antibody was raised against synthetic 17 amino acid peptide from internal region of human CDHR5 / MUPCDH. Percent identity with other species by BLAST analysis: Human (100%); Monkey, Panda (94%); Gorilla, Orangutan, Marmoset (88%); Mouse, Horse (82%).
DLL4 Rabbit Polyclonal Antibody
AP05661PU-N

USD 550.00

5 Days

DLL4 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to the internal region of human DLL4.
KiSS1 receptor (KISS1R) Rabbit Polyclonal Antibody
TA340628

USD 515.00

5 Days

Rabbit Polyclonal Anti-KISS1R Antibody (N-Terminus)

Applications IHC
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen KISS1R / GPR54 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human KISS1R / GPR54. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Mouse, Rat, Bat (83%).
OXGR1 Rabbit Polyclonal Antibody
TA317122

USD 515.00

5 Days

GPR80 / OXGR1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Gibbon (Predicted: Monkey)
Conjugation Unconjugated
Immunogen GPR80 / GPR99 / OXGR1 antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human OXGR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (93%); Panda, Bovine, Dog, Bat (87%); Elephant, Horse, Rabbit (80%).