Antibodies

View as table Download

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

RELA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human RELA (NP_068810). The exact sequence is proprietary.

FOXO3 (221-270) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 221-270 of Human FoxO3A

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications Phospho-specific

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal NFkB1/NFkB p105 Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an N-terminal region of the human NFkB p105/p50 protein (within residues 400-590). [Swiss-Prot P19838]

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932
Modifications Phospho-specific

Anti-NFKBIE Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon

Anti-NFKBIE Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon

Anti-TP73 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 131-310 amino acids of human tumor protein p73

Anti-TP73 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 131-310 amino acids of human tumor protein p73

Rabbit anti-TP53 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53

Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)

Applications IF, IHC, WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920)