Antibodies

Jump to Filters
View as table Download
CBL Rabbit Polyclonal Antibody
TA890105S

USD 188.00

2 Days

Rabbit Polyclonal anti-CBL Antibody

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CBL
ITCH Rabbit Polyclonal Antibody
TA312425

USD 380.00

In Stock

Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N).
Modifications Phospho-specific
BRCA1 Rabbit Polyclonal Antibody
TA313516

USD 380.00

In Stock

Rabbit polyclonal BRCA1 (Ser1457) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1457 (L-T-SP-Q-K).
Modifications Phospho-specific
TRIM32 Rabbit Polyclonal Antibody
TA343687

USD 485.00

5 Days

Rabbit Polyclonal Anti-TRIM32 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK
BRCA1 Rabbit Polyclonal Antibody
TA327807

USD 380.00

In Stock

Rabbit Polyclonal Phospho-BRCA1 (Ser1423) Antibody (Phospho-specific)

Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BRCA1 around the phosphorylation site of Serine 1423
Modifications Phospho-specific
BRCA1 Rabbit Polyclonal Antibody
TA327808

USD 380.00

In Stock

Rabbit Polyclonal Phospho-BRCA1 (Ser1524) Antibody (Phospho-specific)

Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BRCA1 around the phosphorylation site of Serine 1524
Modifications Phospho-specific
Von Hippel Lindau (VHL) Rabbit Polyclonal Antibody
TA327866

USD 380.00

In Stock

Rabbit Polyclonal VHL Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human VHL
BRCA1 Rabbit Polyclonal Antibody
TA333172

USD 450.00

3 Weeks

Phospho-BRCA1-S988 Rabbit Polyclonal Antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S988 of human BRCA1
Modifications Phospho-specific