Antibodies

View as table Download

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit Polyclonal Anti-ATF4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ATF4

Rabbit Polyclonal Anti-EP300 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EP300

Rabbit polyclonal anti-p300 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human p300.

Rabbit polyclonal anti-P300/CBP antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human P300/CBP.

ATF4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ATF4

Rabbit Polyclonal Anti-P300/CBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP

Rabbit Polyclonal Anti-ATF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the middle region of human ATF4. Synthetic peptide located within the following region: LGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGS

Rabbit anti-ATF4 (Phospho-Ser245) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanATF4 around the phosphorylation site of serine 245 (N-R-SP-L-P).
Modifications Phospho-specific

Rabbit polyclonal ATF4(Ab-245) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human ATF4 around the phosphorylation site of Serine 245.

Rabbit polyclonal ATF-4 (Ab-219) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ATF4.

Rabbit polyclonal ATF4 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 171-198 amino acids from the Central region of human ATF4.

Rabbit Polyclonal Anti-ATF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF4 antibody: synthetic peptide directed towards the C terminal of human ATF4. Synthetic peptide located within the following region: EQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLK

Rabbit Polyclonal Anti-p300 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-p300 Antibody: A synthesized peptide derived from human p300

Rabbit Polyclonal Anti-p300 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-p300 Antibody: A synthesized peptide derived from human p300