Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
RELA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human RELA (NP_068810). The exact sequence is proprietary. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Anti-NFKBIE Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon |
Anti-NFKBIE Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 63-423 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Phospho-STAT3(S727) Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STAT3 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S727 of human STAT3. |
| Modifications | Phospho-specific |
Anti-PPARA rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of Human peroxisome proliferator-activated receptor alpha |
TA321679 is a possible alternative to TA321680.
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Active filters
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transcription Factors
Pathways
- Adipocytokine signaling pathway