Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-ERCC5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ERCC5. |
Antibodies
View as table Download
Rabbit polyclonal anti-TF2H2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2. |
Rabbit polyclonal anti-MAT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAT1. |
Rabbit Polyclonal XPG Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
CCNH Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCNH |
MNAT1 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNAT1 |
ERCC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ERCC3 |
Rabbit Polyclonal anti-CCNH antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the N terminal of human CCNH. Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY |
Rabbit Polyclonal anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 antibody is: synthetic peptide directed towards the N-terminal region of Human CDK7. Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG |
Rabbit Polyclonal anti-GTF2H3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIA |
Rabbit Polyclonal Anti-ERCC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA |
Rabbit Polyclonal Anti-ERCC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the N terminal of human GTF2H2. Synthetic peptide located within the following region: DILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTL |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the middle region of human GTF2H2. Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD |
Active filters
Reactivities
- Human
Antibody Hosts
- Rabbit
Isotypes
- IgG
Families
- Transcription Factors
Pathways
- Nucleotide excision repair