Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-OR5AK3P antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR5AK3P. |
MOK protein kinase (MOK) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human RAGE |
Rabbit Polyclonal Anti-PAFAH1B3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B3 antibody: synthetic peptide directed towards the middle region of human PAFAH1B3. Synthetic peptide located within the following region: GHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVN |
Rabbit Polyclonal Anti-RAGE Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAGE antibody: synthetic peptide directed towards the middle region of human RAGE. Synthetic peptide located within the following region: TTNLSPQCLSLLHAMVAYDPDERIAAHQALQHPYFQEQRKTEKRALGSHR |
Rabbit Polyclonal Anti-RAGE Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAGE antibody: synthetic peptide directed towards the N terminal of human RAGE. Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL |
Rabbit Polyclonal Anti-MOK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MOK Antibody: A synthesized peptide derived from human MOK |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- MOK PROTEIN KINASE
Antibody Hosts
- Rabbit
Families
- Protein Kinase