Antibodies

Jump to Filters
View as table Download
TMPRSS3 Rabbit Polyclonal Antibody
AP20427PU-N

USD 465.00

3 Weeks

TMPRSS3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
TMPRSS3 Rabbit Polyclonal Antibody
TA315740

USD 380.00

In Stock

Rabbit polyclonal anti-TMPRSS3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TMPRSS3.
TMPRSS3 Rabbit Polyclonal Antibody
TA351824

USD 380.00

In Stock

Rabbit Polyclonal Anti-TMPRSS3 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human TMPRSS3
TMPRSS3 Rabbit Polyclonal Antibody
TA344653

USD 539.00

5 Days

Rabbit Polyclonal Anti-TMPRSS3 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS3 antibody: synthetic peptide directed towards the N terminal of human TMPRSS3. Synthetic peptide located within the following region: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFP