Antibodies

View as table Download

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC25B

Rabbit polyclonal CDC25A (Ab-178) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P).

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE

Rabbit polyclonal CDC25A (Ser75) antibody(Phospho-specific)

Applications IHC, WB
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of Ser75
Modifications Phospho-specific

Rabbit polyclonal CDC25A (Ser178) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P).
Modifications Phospho-specific

Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CDC25B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS

Rabbit Polyclonal CDC25A (Ser124) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 124
Modifications Phospho-specific

Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P).
Modifications Phospho-specific

Rabbit polyclonal anti-CC14A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CC14A.

Rabbit Polyclonal CDC25A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25A

Rabbit Polyclonal CDC25A (Ser178) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 178
Modifications Phospho-specific

Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25A around the phosphorylation site of Serine 75
Modifications Phospho-specific

Rabbit Polyclonal CDC25B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B

Rabbit Polyclonal CDC25B (Ser323) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25B around the phosphorylation site of Serine 323
Modifications Phospho-specific