Antibodies

Jump to Filters
View as table Download
beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody
AP51124PU-N

USD 580.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.
WNT2 Rabbit Polyclonal Antibody
TA351948

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2
WNT3A Rabbit Monoclonal Antibody [Clone ID: OTIR4G6]
TA592927

USD 428.00

In Stock

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
WNT3A Rabbit Polyclonal Antibody
TA349804

USD 380.00

In Stock

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A
GLI1 Rabbit Polyclonal Antibody
TA309673

USD 550.00

In Stock

Rabbit Polyclonal Gli1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]
GLI2 Rabbit Polyclonal Antibody
TA329437

USD 485.00

5 Days

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE
WNT5A Rabbit Polyclonal Antibody
TA329908

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT
GLI3 Rabbit Polyclonal Antibody
TA319303

USD 765.00

2 Weeks

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Monkey, Xenopus, Dog, Chimpanzee, Chicken, Quail
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.
BMP2 (aa 261-290) Rabbit Polyclonal Antibody
AP20597PU-N

USD 445.00

3 Weeks

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.
BMP2 Rabbit Polyclonal Antibody
TA336740

USD 550.00

2 Weeks

Rabbit Polyclonal BMP-2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]
Smoothened (SMO) (N-term) Rabbit Polyclonal Antibody
AP23648PU-N

USD 500.00

2 Weeks

Smoothened (SMO) (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SMO antibody was raised against synthetic peptide - KLH conjugated
Smoothened (SMO) Rabbit Polyclonal Antibody
TA322573

USD 380.00

In Stock

Anti-SMO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 772-787 amino acids of human smoothened, frizzled family receptor
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA323715

USD 380.00

In Stock

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA323716

USD 380.00

In Stock

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA350653

USD 380.00

In Stock

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DVL2