Antibodies

View as table Download

Rabbit Polyclonal Anti-LRRC57 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LRRC57

LRRC57 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 205-235 amino acids from the C-terminal region of human LRRC57

Rabbit polyclonal Anti-LRRC57 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC57 antibody: synthetic peptide directed towards the N terminal of human LRRC57. Synthetic peptide located within the following region: MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Rabbit polyclonal Anti-LRRC57 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC57 antibody: synthetic peptide directed towards the middle region of human LRRC57. Synthetic peptide located within the following region: NNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQL