Rabbit Polyclonal Anti-CSNK1G2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the middle region of human CSNK1G2. Synthetic peptide located within the following region: SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR |
CSNK1G2 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CSNK1G2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSNK1G2 antibody: synthetic peptide directed towards the N terminal of human CSNK1G2. Synthetic peptide located within the following region: FDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTK |
Germany
Japan
United Kingdom
China
