IGFBP7 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (> 98%) E.coli derived recombinant Human IGFBP7 (Cat.-No AR09501PU). |
IGFBP7 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (> 98%) E.coli derived recombinant Human IGFBP7 (Cat.-No AR09501PU). |
Anti-IGFBP7 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 270-282 amino acids of Human insulin-like growth factor binding protein 7 |
Anti-IGFBP7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 270-282 amino acids of Human insulin-like growth factor binding protein 7 |
IGFBP7 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (> 98%) E.coli derived recombinant Human IGFBP7 (Cat.-No AR09501PU). |
IGFBP7 Rabbit monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IGFBP7 Rabbit polyclonal Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human IGFBP7 |
Rabbit Polyclonal Anti-IGFBP7 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGFBP7 antibody: synthetic peptide directed towards the C terminal of human IGFBP7. Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH |
IGFBP7 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-282 of human IGFBP7 (NP_001544.1). |
Modifications | Unmodified |
Anti-IGFBP7 antibody(DMC422), IgG1 Chimeric mAb
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |