Antibodies

View as table Download

Anti-PTGES2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2

PTGES2 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 88-377 of human PTGES2 (NP_079348.1).
Modifications Unmodified

Anti-PTGES2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-377 amino acids of human prostaglandin E synthase 2

Rabbit Polyclonal Anti-Ptges2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ptges2 antibody is: synthetic peptide directed towards the middle region of Mouse Ptges2. Synthetic peptide located within the following region: GAAAMYLISKRLKSRHHLQDDVRVDLYEAANKWVTAVGKDRPFMGGQKPN

Rabbit Polyclonal Anti-Ptges2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ptges2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Ptges2. Synthetic peptide located within the following region: RLLGAAALALGGALGLYHTVRWHQRSQDLRAERSAAQLPLSNSLQLTLYQ

PTGES2 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 88-377 of human PTGES2 (NP_079348.1).
Modifications Unmodified