Antibodies

Jump to Filters
View as table Download
FOLH1B Rabbit Polyclonal Antibody
TA351197

USD 380.00

In Stock

Rabbit Polyclonal Anti-FOLH1B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOLH1B
FOLH1B Rabbit Polyclonal Antibody
TA367057

USD 380.00

4 Weeks

FOLH1B rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOLH1B
FOLH1B Rabbit Polyclonal Antibody
TA337314

USD 539.00

5 Days

Rabbit Polyclonal Anti-FOLH1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FOLH1B antibody is: synthetic peptide directed towards the middle region of Human FOLH1B. Synthetic peptide located within the following region: ELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLG