Antibodies

View as table Download

Rabbit Polyclonal Anti-JAK3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-JAK3 Antibody: synthetic peptide directed towards the middle region of human JAK3. Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF

Rabbit anti JAK3 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from the adjacent to C-terminus of JAK3 protein. This sequence is identical in JAK3 from human, rat and mouse origins.