Antibodies

Jump to Filters
View as table Download
FGR Rabbit Polyclonal Antibody
TA312207

USD 380.00

In Stock

Rabbit polyclonal anti-FGR antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FGR.
FGR Rabbit Polyclonal Antibody
TA327258

USD 365.00

3 Weeks

Rabbit anti-FGR Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human FGR
FGR Rabbit Polyclonal Antibody
TA334987

USD 539.00

5 Days

Rabbit Polyclonal Anti-FGR Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FGR antibody: synthetic peptide directed towards the middle region of human FGR. Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ