Rabbit Polyclonal PEN2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2. |
Rabbit Polyclonal PEN2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PEN2 antibody was raised against a 13 amino acid peptide from near the amino terminus of human PEN2. |
Rabbit Polyclonal PEN2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PEN2 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human PEN2. |
Rabbit Polyclonal Anti-PSENEN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSENEN antibody: synthetic peptide directed towards the C terminal of human PSENEN. Synthetic peptide located within the following region: SQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGT |