Rabbit Polyclonal Anti-PSEN1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY |
Rabbit Polyclonal Frizzled-10 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acid 150-200 of human Frizzled-10 was used as the immunogen |
Rabbit anti LRP5 (Non-phospho) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope KATLY of human LRP5 protein |
Rabbit anti LRP6 (Non-phospho) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope KGTYF of human LRP6 protein |
WNT9A (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human WNT9A |
Germany
Japan
United Kingdom
China