Rabbit anti-UGT2B7 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT2B7 |
Rabbit anti-UGT2B7 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT2B7 |
Rabbit Polyclonal Anti-UGT1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A1 antibody: synthetic peptide directed towards the middle region of human UGT1A1. Synthetic peptide located within the following region: ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH |
Rabbit Polyclonal Anti-UGT1A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A4 antibody: synthetic peptide directed towards the N terminal of human UGT1A4. Synthetic peptide located within the following region: VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK |
Rabbit Polyclonal anti-UGT1A9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |
Rabbit polyclonal Anti-UGT1A5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A5 antibody: synthetic peptide directed towards the N terminal of human UGT1A5. Synthetic peptide located within the following region: EENFFTLTTYAISWTQDEFDRLLLGHTQSFFETEHLLMKFSRRMAIMNNM |
Rabbit anti-UGT1A4 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A4 |
Rabbit Polyclonal Anti-UGT2B4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B4 antibody: synthetic peptide directed towards the N terminal of human UGT2B4. Synthetic peptide located within the following region: NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the N terminal of human UGT2A3. Synthetic peptide located within the following region: NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN |
Rabbit Polyclonal Anti-UGT2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2A3 antibody: synthetic peptide directed towards the middle region of human UGT2A3. Synthetic peptide located within the following region: GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR |
Rabbit Polyclonal Anti-UGT1A6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A6 antibody: synthetic peptide directed towards the C terminal of human UGT1A6. Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK |
Rabbit Polyclonal Anti-UGT2B15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT2B15 antibody: synthetic peptide directed towards the N terminal of human UGT2B15. Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY |
UGT1A4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A4 |
UGT1A5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UGT1A5 |
UGT2B4 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UGT2B4 |