Antibodies

View as table Download

Anti-HMGA1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1

Rabbit polyclonal HMGA1 Antibody (C-term)

Applications FC, IF, WB
Reactivities Human (Predicted: Mouse, Rat, Hamster)
Conjugation Unconjugated
Immunogen This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1.

Anti-HMGA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1

Rabbit Polyclonal Anti-Hmga1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Hmga1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hmga1. Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE