Anti-HMGA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
Anti-HMGA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
Rabbit polyclonal HMGA1 Antibody (C-term)
Applications | FC, IF, WB |
Reactivities | Human (Predicted: Mouse, Rat, Hamster) |
Conjugation | Unconjugated |
Immunogen | This HMGA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 64-93 amino acids from the C-terminal region of human HMGA1. |
Anti-HMGA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 12-24 amino acids of Human high mobility group AT-hook 1 |
Rabbit Polyclonal Anti-Hmga1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Hmga1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hmga1. Synthetic peptide located within the following region: MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPSVSPGTALVGSQKEPSE |