Rabbit polyclonal CCL2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
Albumin (ALB) (C-term) rabbit polyclonal antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Horse, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from 540-569 aa the C-terminal region of human ALB. |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse, Orang-Utan (Predicted: Bat, Bovine, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
Rabbit polyclonal TTR Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This TTR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-98 amino acids from the C-terminal region of human TTR. |
Rabbit polyclonal antibody to Factor IX (coagulation factor IX)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Dog, Monkey, Pig, Rabbit, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 217 and 453 of Factor IX (Uniprot ID#P00740) |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Gibbon (Predicted: Mouse, Rat, Bat, Hamster, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Dog, Bovine (100%); Mouse, Rat, Hamster, Bat, Rabbit (94%); Opossum (81%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Human, Monkey, Rabbit, Gibbon (Predicted: Rat, Hamster) |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Rabbit (100%); Rat, Hamster, Opossum (94%). |
Rabbit polyclonal IL4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
Rabbit Polyclonal Anti-WNT5B Antibody (Internal)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey, Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | WNT5B antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT5B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Marmoset, Bovine, Dog, Elephant, Panda, Horse, Rabbit, Pig, Platypus (100%); Gibbon, Monkey, Mouse, Rat, Opossum (93%); Hamster (87%); Xenopus (80%). |
Rabbit Polyclonal Anti-DPP4 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey, Horse) |
| Conjugation | Unconjugated |
| Immunogen | DPP4 / CD26 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human CD26. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey (100%); Orangutan, Galago, Marmoset, Horse (94%); Elephant, Dog, Pig (89%); Panda, Cat (83%). |
Rabbit Polyclonal Antibody against APOE (C-term)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Monkey, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This APOE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the C-terminal region of human APOE. |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal Anti-PIGR Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | PIGR antibody was raised against synthetic 19 amino acid peptide from extracellular domain of human PIGR. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (95%); Orangutan, Marmoset (89%). |
Growth Hormone (GH1) (1-217) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 217 of Human Growth hormone |
Rabbit Polyclonal Anti-HSD17B11 Antibody
| Applications | IHC |
| Reactivities | Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
Germany
Japan
United Kingdom
China
