Rabbit polyclonal anti-OR4A15 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR4A15. |
Rabbit polyclonal anti-OR4A15 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR4A15. |
OR4A15 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 277-306 amino acids from the C-terminal region of Human Olfactory receptor 4A15 |
Rabbit Polyclonal Anti-OR4A15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR4A15 antibody is: synthetic peptide directed towards the N-terminal region of Human OR4A15. Synthetic peptide located within the following region: KNNVTEFILLGLTQNPEGQKVLFVTFLLIYMVTIMGNLLIIVTIMASQSL |