Antibodies

Jump to Filters
View as table Download
Ephrin B3 (EFNB3) Rabbit Polyclonal Antibody
TA311653

USD 380.00

In Stock

Rabbit polyclonal anti-Ephrin-B3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ephrin-B3.
Ephrin B3 (EFNB3) Rabbit Polyclonal Antibody
TA350660

USD 380.00

In Stock

Rabbit Polyclonal Anti-EFNB3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EFNB3
Ephrin B3 (EFNB3) Rabbit Polyclonal Antibody
TA343334

USD 539.00

5 Days

Rabbit Polyclonal Anti-EFNB3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Efnb3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Efnb3. Synthetic peptide located within the following region: AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE