Antibodies

Jump to Filters
View as table Download
OR7A5 Rabbit Polyclonal Antibody
TA360413

USD 539.00

5 Days

OR7A5 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR7A5
cGKI (PRKG1) Rabbit Polyclonal Antibody
TA361277

USD 539.00

5 Days

PRKG1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PRKG1
CNG3 (CNGA3) Rabbit Polyclonal Antibody
TA361280

USD 539.00

5 Days

CNGA3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CNGA3
PRKX Rabbit Polyclonal Antibody
TA362115

USD 539.00

5 Days

PRKX Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRKX
CAMK2D Rabbit Polyclonal Antibody
TA362576

USD 539.00

5 Days

CAMK2D Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CAMK2D
PHOS (PDC) Rabbit Polyclonal Antibody
TA362583

USD 539.00

5 Days

PDC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PDC
PHOS (PDC) Rabbit Polyclonal Antibody
TA362716

USD 539.00

5 Days

PDC Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PDC
OR1A1 Rabbit Polyclonal Antibody
TA363625

USD 539.00

5 Days

OR1A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human OR1A1
cGKI (PRKG1) Rabbit Polyclonal Antibody
TA363663

USD 539.00

5 Days

PRKG1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PRKG1
CAMK2G Rabbit Polyclonal Antibody
TA363772

USD 539.00

5 Days

CAMK2G Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CAMK2G
OR1C1 Rabbit Polyclonal Antibody
TA342694

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR1C1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR1C1 antibody: synthetic peptide directed towards the C terminal of human OR1C1. Synthetic peptide located within the following region: AVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVL
OR2G2 Rabbit Polyclonal Antibody
TA357620

USD 539.00

5 Days

OR2G2 Antibody - C-terminal region

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human OR2G2
CALM3 Rabbit Polyclonal Antibody
TA327813

USD 380.00

In Stock

Rabbit Polyclonal Phospho-Calmodulin (Thr79+Ser81) Antibody (Phospho-specific)

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Calmodulin around the phosphorylation site of Threonine 79+Serine 81
Modifications Phospho-specific
CAMK2A Rabbit Polyclonal Antibody
TA327898

USD 380.00

In Stock

Rabbit Polyclonal CaMK2 alpha/beta/delta Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CaMK2 alpha/beta/delta
CAMK2G Rabbit Polyclonal Antibody
TA354478

USD 410.00

5 Days

Rabbit anti CamKII(pT286) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated